PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK13930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 243aa    MW: 27619.5 Da    PI: 8.5164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK13930.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
        PK13930.1 14 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding538.1e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
        PK13930.1  67 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-23764IPR009057Homeodomain-like
PROSITE profilePS5129416.294961IPR017930Myb domain
SuperFamilySSF466895.08E-2812108IPR009057Homeodomain-like
SMARTSM007171.3E-91363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
CDDcd001672.78E-81761No hitNo description
PROSITE profilePS5129425.71662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2665117IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567110IPR001005SANT/Myb domain
CDDcd001679.93E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
NNNNTNNNNN KLRKGLWSPE EDDKLMNYML NNGQGCWSDV ARNAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPQEEELIIH LHSLLGNRWS QIAARLPGRT DNEIKNFWNS TVKKRLKNLS  120
SSSTTSPNTS DSSFELKDSS SISMDTNNNN NKIIINNIIP GASSQDQNTM FSTSYLHDLS  180
SPTSLHHLIR PFPAMQFDHH HHHHNNMFGT SNSNEFLNNN INPISSQIAG MVNNNDHDNL  240
GFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-27911622128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102340.11e-107Transcription factor
TrEMBLW9RIA11e-107W9RIA1_9R
STRINGPOPTR_0009s05860.11e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-61myb domain protein 46